PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn249161
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 83aa    MW: 9602.3 Da    PI: 9.4086
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn249161genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260103.51.8e-321082173
      DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPv 73
                +CaaCk+lrr+C+++C+lapyfp+++p kf  +h+ FGasn++k+l++lpe++reda++s+vyeA+ar +dPv
  Achn249161 10 PCAACKILRRRCVEKCILAPYFPHTDPLKFTLAHRHFGASNIIKFLQELPESHREDAVKSMVYEANARFKDPV 82
                7***********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.583982IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-311082IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
MNMNMIERRP CAACKILRRR CVEKCILAPY FPHTDPLKFT LAHRHFGASN IIKFLQELPE  60
SHREDAVKSM VYEANARFKD PV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003536369.13e-41PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9SK082e-41LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0A0KNK92e-41A0A0A0KNK9_CUCSA; Uncharacterized protein
TrEMBLA0A0B2Q7753e-41A0A0B2Q775_GLYSO; LOB domain-containing protein 1
STRINGGLYMA10G35760.19e-41(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.11e-42LOB domain-containing protein 11